Skip to product information
1 of 1

Gene Bio Systems

Recombinant Zea mays Cell number regulator 9(CNR9)

Recombinant Zea mays Cell number regulator 9(CNR9)

SKU:CSB-CF518899ZAX

Regular price £1,245.00 GBP
Regular price Sale price £1,245.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Zea mays (Maize)

Uniprot NO.:D9HP25

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYPAKPAASSSQPAAEMAQPVVGIPISSPGAVAVGPVVGKWSSGLCACSDDCGLCCLTCW CPCITFGRIAEIVDRGATSCGVAGTIYTLLACFTGCHWIYSCTYRSRMRAQLGLPEACCC DCCVHFCCEPCALSQQYRELKARGFDPDLGWDVNAQKAAAAAAMYPPPAEGMMIR

Protein Names:Recommended name: Cell number regulator 9 Alternative name(s): ZmCNR09

Gene Names:Name:CNR9

Expression Region:1-175

Sequence Info:full length protein

View full details