Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yersinia pestis bv. Antiqua UPF0059 membrane protein YPA_1126(YPA_1126)

Recombinant Yersinia pestis bv. Antiqua UPF0059 membrane protein YPA_1126(YPA_1126)

SKU:CSB-CF624538YAF

Regular price £1,277.00 GBP
Regular price Sale price £1,277.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yersinia pestis bv. Antiqua (strain Antiqua)

Uniprot NO.:Q1C8X9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSATIILAFAMSMDAFAASIGKGATLYKPRFREALRTGLIFGVIEAITPLIGWCIGLF ASQYIMEWDHWIAFSLLFILGCRMIFEGMKQRVAETEKMRSHSFWVLVTTAIATSLDAMA IGVGLAFLQVDIVHTAMAIGLATMIMATLGMLIGRYIGPLLGKRAEIIGGIVLIGIGFNI LYEHMHLTA

Protein Names:Recommended name: UPF0059 membrane protein YPA_1126

Gene Names:Ordered Locus Names:YPA_1126

Expression Region:1-189

Sequence Info:full length protein

View full details