Skip to product information
1 of 1

Gene Bio Systems

Recombinant Yarrowia lipolytica Golgi to ER traffic protein 1(GET1)

Recombinant Yarrowia lipolytica Golgi to ER traffic protein 1(GET1)

SKU:CSB-CF718481YAP

Regular price £1,316.00 GBP
Regular price Sale price £1,316.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)

Uniprot NO.:Q6C555

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDEAIIVDAEFVAPVGTTAGEFVPIDRAPAAGLLLLVAFVVLYAKVISKLGKPAIQEFLW EIITRIVPSKQLRRRKEAQLRAIEVHTQRSNTSSQDQFAKWAKLDREYGKLKVEIEDINN LLTASKARFFTIISSAIFLSTTGMKMFLRIKHRKAAIFWLPKNAFPYPIEYILSFSSAPL GSVSVSAWLMICDAAMDLIVTIFVALVVGVIGMLRSNKVKPKTA

Protein Names:Recommended name: Golgi to ER traffic protein 1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:GET1 Ordered Locus Names:YALI0E20889g

Expression Region:1-224

Sequence Info:full length protein

View full details