Gene Bio Systems
Recombinant Xenopus tropicalis UPF0444 transmembrane protein C12orf23 homolog
Recombinant Xenopus tropicalis UPF0444 transmembrane protein C12orf23 homolog
SKU:CSB-CF750785XBF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q6P1V1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSQTEKIEEAVPSYLCEEPPEGTVKDHPQQQPGMISRVTGGIFSMTKGAVGATIGGVAWI GGKSYEVTKTAVTSVPSIGVGIVKGSVSAVTGSVAAVGSVVSSKVSGKKKDKSD
Protein Names:Recommended name: UPF0444 transmembrane protein C12orf23 homolog
Gene Names:
Expression Region:1-114
Sequence Info:full length protein
