Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Ubiquitin carboxyl-terminal hydrolase 30(usp30)

Recombinant Xenopus tropicalis Ubiquitin carboxyl-terminal hydrolase 30(usp30)

SKU:CSB-CF025721XBF

Regular price £1,567.00 GBP
Regular price Sale price £1,567.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:A4QNN3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSWAPVSTWSRRTPLAACCSAPELPPAGAWKACAAGSLRIGPQGRCKMMKNWGMIGGIAAALAAGIYVLWGPISDRKKYRKGLVPGLLNLGNTCFMNSLLQGLASCPSFIRWLADFTSKYRQENNTTEHQHLSVTLLHLLKALCNQEGTEDEVLDASPLLEVLRAHRWQISSFEEQDAHELFHVLTSSLEDERDRRPHVTHLFDLDSLEFPLEPQRQIHCRTQVPIYPIPSQWKSQHPFHGRLTSNMVCKHCQHQSPMRYDTFDSLSLSIPVATWGHPITLDQCLQHFISTESVKDVVCENCTKIHAAQIPNSQSVENRKTTFVKQLKLGKLPQCLCIHLQRLSWSNQGSPLKRNEHVQFSEFLAMDRFKYRISGCSTSKQPANHLSAAEQETTDGKEGGAQNPTMPFLNGACSTSYISPPFTSPLPTNPEWTSSSYLFRLMAVVVHHGDMHSGHFVTYRRSPAAKNQKLTSQQWLWISDDTVRRTNFQEVLSSSAYLLFYERIQSNLHHPEDQRAAEK

Protein Names:Recommended name: Ubiquitin carboxyl-terminal hydrolase 30 EC= 3.4.19.12 Alternative name(s): Deubiquitinating enzyme 30 Ubiquitin thioesterase 30 Ubiquitin-specific-processing protease 30 Short name= Ub-specific protease 30

Gene Names:Name:usp30 ORF Names:TEgg099b09.1

Expression Region:1-519

Sequence Info:full length protein

View full details