Gene Bio Systems
Recombinant Xenopus tropicalis ER lumen protein retaining receptor 1(kdelr1)
Recombinant Xenopus tropicalis ER lumen protein retaining receptor 1(kdelr1)
SKU:CSB-CF716821XBF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Uniprot NO.:Q5XHA2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNIFRFLGDISHLSAILILLLKIWKSRSCAGISGKSQLLFAIVFTTRYLDLFTNFISLYN TSMKMVYVASSYATIWMIYSKFKATYDGNHDTFRVEFLIVPTAILAFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGIYRALYLFNWIWRYQFEGFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA
Protein Names:Recommended name: ER lumen protein retaining receptor 1 Alternative name(s): KDEL endoplasmic reticulum protein retention receptor 1 Short name= KDEL receptor 1
Gene Names:Name:kdelr1 ORF Names:TGas070a01.1
Expression Region:1-212
Sequence Info:full length protein
