Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Cysteine-rich and transmembrane domain-containing protein 1(cystm1)

Recombinant Xenopus tropicalis Cysteine-rich and transmembrane domain-containing protein 1(cystm1)

SKU:CSB-CF634722XBF

Regular price £1,215.00 GBP
Regular price Sale price £1,215.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q28H62

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNYENPPPYASPPAPYPPYGQQQPSYPVPNQYPGNPPGPVGYQPAQPGYQGYPQYGWQGA PPANAPVYMDAPKNTVYVVEERRNDTSGESACLTACWTALCCCCLWDMLT

Protein Names:Recommended name: Cysteine-rich and transmembrane domain-containing protein 1

Gene Names:Name:cystm1 ORF Names:TEgg056l06.1

Expression Region:1-110

Sequence Info:full length protein

View full details