Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 90B, mitochondrial(ccdc90b)

Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 90B, mitochondrial(ccdc90b)

SKU:CSB-CF728546XBF

Regular price £1,285.00 GBP
Regular price Sale price £1,285.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Uniprot NO.:Q6DJ87

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ATSAALPAGYDVRQVEITPLEQRKLTFDTHALVRELETHGFDKVQAETIVSALATLTNAS IDTVYRDMVTRAQQEITVQQIMAHLDSIRKDMVILEKSEFATLRAENEKMKIELEHVRQH LLNETNRISADAKLDMNLERSRLTDLFTEQEKKLMEASTEFHKKNATTDSVITEINKKID IDIASLKTLMESHKLDTVRYMAASVFTCLAIALGFYRLWK

Protein Names:Recommended name: Coiled-coil domain-containing protein 90B, mitochondrial

Gene Names:Name:ccdc90b

Expression Region:48-267

Sequence Info:full length protein

View full details