Recombinant Xenopus laevis Vesicle-associated membrane protein 2(vamp2)

SKU: CSB-CF025781XBE

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:P47193

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SAPAAGPPAAAPGDGAPQGPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDTKLSELDDRADALQAGASQFETSAAKLKRKYWWKNMKMMIIMGVICAIILIIIIVYFST

Protein Names:Recommended name: Vesicle-associated membrane protein 2 Short name= VAMP-2 Alternative name(s): SYBII Synaptobrevin-2

Gene Names:Name:vamp2

Expression Region:2-114

Sequence Info:full length protein