Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Trimeric intracellular cation channel type B-A(tmem38b-a)

Recombinant Xenopus laevis Trimeric intracellular cation channel type B-A(tmem38b-a)

SKU:CSB-CF665979XBE

Regular price £1,345.00 GBP
Regular price Sale price £1,345.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q3KQE5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESLSELSVQFSQLSMFPFFDMAHYVVSVMSAREQAGALDIAARSPMASWFSAMLYCFGG GILSSILLAEPPIAVLSNTTNIMLASTIWYMVYYFPYDLFYNCFFFLPIRLIIAGMKEVT RTWKILSGVTHAHSHYKDALLVMITIGWARGAGGGLISNFEQLVRGVWKPESNEFLKMSY PVKVTLIGAVLFTLQHGHYLPISRHNLMLIYTMFLVLIKVTMMLTHSTASPFLPLETPLQ RILFGQRQKPSEVRQSASSSGAKGKPSKKTLDKDSGEQSKKKDS

Protein Names:Recommended name: Trimeric intracellular cation channel type B-A Short name= TRIC-B-A Short name= TRICB-A Alternative name(s): Transmembrane protein 38B-A

Gene Names:Name:tmem38b-a

Expression Region:1-284

Sequence Info:full length protein

View full details