Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Sodium-potassium-transporting ATPase subunit gamma(fxyd2)

Recombinant Xenopus laevis Sodium-potassium-transporting ATPase subunit gamma(fxyd2)

SKU:CSB-CF009090XBE

Regular price £1,147.00 GBP
Regular price Sale price £1,147.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:O13001

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADAQDDMSQMQDKFTYDYETIRKGGLIFAAIAFVVGMLIIFSGRFRCGRKKQLRALNDD M

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit gamma Short name= Na(+)/K(+) ATPase subunit gamma Alternative name(s): FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

Gene Names:Name:fxyd2

Expression Region:1-61

Sequence Info:full length protein

View full details