Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Serine palmitoyltransferase small subunit A-A(sptssa-a)

Recombinant Xenopus laevis Serine palmitoyltransferase small subunit A-A(sptssa-a)

SKU:CSB-CF721084XBE

Regular price £1,164.00 GBP
Regular price Sale price £1,164.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q66J44

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKVLCEDVNGPRSSLGRAWSHMSWLYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYT GYIFMPQHILAILHYFEIVQ

Protein Names:Recommended name: Serine palmitoyltransferase small subunit A-A Alternative name(s): Small subunit of serine palmitoyltransferase A-A Short name= ssSPTa-A

Gene Names:Name:sptssa-a Synonyms:ssspta-a

Expression Region:1-80

Sequence Info:full length protein

View full details