Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Ribonuclease kappa-A(rnasek-a)

Recombinant Xenopus laevis Ribonuclease kappa-A(rnasek-a)

SKU:CSB-CF384848XBE

Regular price £1,181.00 GBP
Regular price Sale price £1,181.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:A2VDC7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSLLCCGPKLAACGIVISVWGVIMLILLGVFFNVHSAVLIEDVPFTEEDIFEDPNPPAK MYRLYEQVSYNCFIAAAIYIVLGGFSFCQVRLNKRKEYMVR

Protein Names:Recommended name: Ribonuclease kappa-A Short name= RNase K-A Short name= RNase kappa-A EC= 3.1.-.-

Gene Names:Name:rnasek-a

Expression Region:1-101

Sequence Info:full length protein

View full details