Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis Hyaluronan synthase 3(has3)

Recombinant Xenopus laevis Hyaluronan synthase 3(has3)

SKU:CSB-CF010142XBE-GB

Regular price £1,258.00 GBP
Regular price Sale price £1,258.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:O57426

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SYFGCVQCISGPLGMYRNSLLQYFLEDWYHQTFLGQKCSFGDDRHLTNRVLSMGFRTKYT ARSRCLTETPTRYLRWLNQQTRWSKSYFREWLYNALWFHKHHLWMTYESVVTGFFPFFLV ATVVQLFYRGRVWNILLFLLTVQLVGILKATYACILRGNAEMIFMSLYSLLYMTSLLPAK IFAVITINKS

Protein Names:Recommended name: Hyaluronan synthase 3 EC= 2.4.1.212 Alternative name(s): Hyaluronate synthase 3 Hyaluronic acid synthase 3 Short name= HA synthase 3 Short name= xHAS3

Gene Names:Name:has3

Expression Region:1-190

Sequence Info:full length protein

View full details