Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis FUN14 domain-containing protein 1A(fundc1-a)

Recombinant Xenopus laevis FUN14 domain-containing protein 1A(fundc1-a)

SKU:CSB-CF691313XBE

Regular price £1,224.00 GBP
Regular price Sale price £1,224.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q58EA0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAARREPSSDDESYEVLDLTDYARRHHWWNRLFGRNSGPLTEKYSVATQIVIGGVSGWCA GFLFQKVGKLAATAVGGGFLLLQIASHGGYIQVDWKRVEKDVNNAKRKIKKEANKSAPEI NTLIEESTDFVKKNIVVSGGFVGGFLLGLAS

Protein Names:Recommended name: FUN14 domain-containing protein 1A

Gene Names:Name:fundc1-a

Expression Region:1-151

Sequence Info:full length protein

View full details