Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xanthomonas axonopodis pv. citri Potassium-transporting ATPase C chain(kdpC)

Recombinant Xanthomonas axonopodis pv. citri Potassium-transporting ATPase C chain(kdpC)

SKU:CSB-CF854409XAD

Regular price £1,161.00 GBP
Regular price Sale price £1,161.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xanthomonas axonopodis pv. citri (strain 306)

Uniprot NO.:Q8PPC8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPLRDDGVLRGSLVLAVFTLFGLGLAYSLIATGITGALFSEQATGSLMRVDARVVGSALV AQPFTDARYFQPRPSAAKYDLTAAAGSNQARSNPDLLARIATTRAQVAARDGIAPEAVPG ELLTQSGSGLDPHLSPAGAQVQIRRVAAARGWPEQRVAALVQATTEAAPQFGLLGQPRVN VLALNLALDQAGNGESGRGNGVKQAH

Protein Names:Recommended name: Potassium-transporting ATPase C chain EC= 3.6.3.12 Alternative name(s): ATP phosphohydrolase [potassium-transporting] C chain Potassium-binding and translocating subunit C Potassium-translocating ATPase C chain

Gene Names:Name:kdpC Ordered Locus Names:XAC0758

Expression Region:1-206

Sequence Info:full length protein

View full details