Skip to product information
1 of 1

Gene Bio Systems

Recombinant Woodchuck hepatitis B virus Large envelope protein(S)

Recombinant Woodchuck hepatitis B virus Large envelope protein(S)

SKU:CSB-CF318123WAX

Regular price £1,345.00 GBP
Regular price Sale price £1,345.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Woodchuck hepatitis B virus (isolate w64/pWS23) (WHV)

Uniprot NO.:P11293

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:PLRDTHPHLTMKNQTFHLQGFVDGLRDLTTTERHHNAYGDPFTTLSPVVPTVSTTLSPPS TTGDPALSPEMSPSSLLGLLAGLQVVYFLWTKIPTIAQNLDWWWTSLSFPGGIPECTGQN SQFQTCKHLPTSCPPTCNGFRWMYLRRFIIYLLVLLLCLIFLLVLLDWKGLLPVCPLQPT TETTVNCRQCTLSVQDTYTPPYCCCLKPTAGNCTCWPIPSSWALGNYLWEWALARFSWLN LLVPLLQWLGGISLIAWFLLIWMIWFWGPALLSILPPFIPIFVLFFLIWVYI

Protein Names:Recommended name: Large envelope protein Alternative name(s): L glycoprotein L-HBsAg Short name= LHB Large S protein Large surface protein Major surface antigen

Gene Names:Name:S

Expression Region:1-292

Sequence Info:full length protein

View full details