Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera Casparian strip membrane protein VIT_14s0108g01050 (VIT_14s0108g01050)

Recombinant Vitis vinifera Casparian strip membrane protein VIT_14s0108g01050 (VIT_14s0108g01050)

SKU:CSB-CF414518VFQ

Regular price £1,260.00 GBP
Regular price Sale price £1,260.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7PMY7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKAGALELGEGSKTSIPRGGVNRGISILDFILRLITIIGTLGSAIAMGTTNETLPFFTQF TQFRAEYDDLPTFTFFVIANSIVSGYLVLSLPMSILHIVRSGARASRIVLIFFDTAMLAL LTAAASAASAIVYLAHKGNAQANWFAICQQFKSFCERISGSLIGSFGGIILFILLVLLSA VALSRC

Protein Names:Recommended name: Casparian strip membrane protein VIT_14s0108g01050

Gene Names:Ordered Locus Names:VIT_14s0108g01050 ORF Names:GSVIVT00020996001, GSVIVT01011443001, VIT_00011443001, Vv14s0108g01050

Expression Region:1-186

Sequence Info:full length protein

View full details