Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera Casparian strip membrane protein VIT_06s0080g00840 (VIT_06s0080g00840)

Recombinant Vitis vinifera Casparian strip membrane protein VIT_06s0080g00840 (VIT_06s0080g00840)

SKU:CSB-CF415228VFQ

Regular price £1,273.00 GBP
Regular price Sale price £1,273.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7QF77

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKSTGEATAINIGETKSASATTVATTKAIQHPKAGLKRGLAIFDFILRLSAIGAALAATT TMGTTDQTLPFFTQFFQFQASYDDLPAFSFFVIANAIASGYLFLSLPFSIVCIVRPHAMG ARLLLVICDTVMVALTIAAAAAAAAIVYLAHNGNSNANWVAICQQFDDFCQSVSGAVVAS FIAAVLFMLMIVLSAFSLRKH

Protein Names:Recommended name: Casparian strip membrane protein VIT_06s0080g00840

Gene Names:Ordered Locus Names:VIT_06s0080g00840 ORF Names:GSVIVT00037312001, GSVIVT01036085001, VIT_00036085001, Vv06s0080g00840

Expression Region:1-201

Sequence Info:full length protein

View full details