Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera CASP-like protein VIT_19s0090g00570 (VIT_19s0090g00570)

Recombinant Vitis vinifera CASP-like protein VIT_19s0090g00570 (VIT_19s0090g00570)

SKU:CSB-CF417264VFQ

Regular price £1,254.00 GBP
Regular price Sale price £1,254.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7P0P3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNLAETAPISSAHIPTLKLIDCSLRLCVIPLSVATIWLTVTNQQDNSIYGKLEFSNLTG LKYMVCISGISAGYALVAVVASWVRCLVNKAWLFFVSDQIMAYLMVTSGAAVLEILYLAY KGDRGVSWSEACSSYGRFCSRVNLALALHALALCCFLVLAVISAYRVFSMFEPPVSSKEV EEERAS

Protein Names:Recommended name: CASP-like protein VIT_19s0090g00570

Gene Names:Ordered Locus Names:VIT_19s0090g00570 ORF Names:GSVIVT00027310001, GSVIVT01037665001, VIT_00037665001, VITISV_007688, Vv19s0090g00570

Expression Region:1-186

Sequence Info:full length protein

View full details