Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera CASP-like protein GSVIVT00034332001 (VIT_09s0002g03780)

Recombinant Vitis vinifera CASP-like protein GSVIVT00034332001 (VIT_09s0002g03780)

SKU:CSB-CF416556VFQ

Regular price £1,281.00 GBP
Regular price Sale price £1,281.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7P756

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNGLKTPPEIGIQLPEAKVAAETGTMSGPLVPPRSDRSVRRGTDVAHVVLRFVCLLTSVI ALSLMATAKEAASISIYGFLLPVSSKWSFSDSFEYLVGVSAAVAAHALLQLIISVSRLLR KSPVIPSRNHAWLIFAGDQAFAYAMLSAGSAASGVTNLNRTGIRHSPLPNFCKPLRSFCD HVAASIAFTFFSCFLLATSAILDVIWLSKY

Protein Names:Recommended name: CASP-like protein GSVIVT00034332001

Gene Names:Ordered Locus Names:VIT_09s0002g03780 ORF Names:GSVIVT00034332001, VITISV_012198

Expression Region:1-210

Sequence Info:full length protein

View full details