Gene Bio Systems
Recombinant Vibrio vulnificus Probable oxaloacetate decarboxylase gamma chain(oadG)
Recombinant Vibrio vulnificus Probable oxaloacetate decarboxylase gamma chain(oadG)
SKU:CSB-CF766072VCQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio vulnificus (strain YJ016)
Uniprot NO.:Q7MHR9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTNIGSLLVDAAALMVTGMGVVFIFLTILIFLVRLMSKLVPQEVPPPITAPKAVKNQANH TSTVSPQVVAAISAAIHQHRASVAK
Protein Names:Recommended name: Probable oxaloacetate decarboxylase gamma chain EC= 4.1.1.3
Gene Names:Name:oadG Ordered Locus Names:VV2800
Expression Region:1-85
Sequence Info:full length protein
