Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio splendidus UPF0208 membrane protein VS_0999 (VS_0999)

Recombinant Vibrio splendidus UPF0208 membrane protein VS_0999 (VS_0999)

SKU:CSB-CF490860VFH

Regular price £1,224.00 GBP
Regular price Sale price £1,224.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32))

Uniprot NO.:B7VLV8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSNRVGLASSLKDGQKYMDLWPVRKELNSIFPEQRIIKATRFGVKVMPAIAAISVLTQMV FNNYQAMPQAVVMALFAISLPLQGMWWLGNRSNTKLPPALVSWYRELHEKITETGFALEP MKSRPRYKELAIILNRAFRQLDKSSMERWF

Protein Names:Recommended name: UPF0208 membrane protein VS_0999

Gene Names:Ordered Locus Names:VS_0999

Expression Region:1-150

Sequence Info:full length protein

View full details