Skip to product information
1 of 1

Gene Bio Systems

Recombinant Variola virus Protein L5 (L5R)

Recombinant Variola virus Protein L5 (L5R)

SKU:CSB-CF327191VAR

Regular price £1,204.00 GBP
Regular price Sale price £1,204.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Uniprot NO.:P33043

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMHKRK IPDPIDRLRRANLACEDDKLMIYGLPWITTQTSALSINSKPIVYKDCAKLLRSINGSQPV SLNDVLRR

Protein Names:Recommended name: Protein L5

Gene Names:ORF Names:L5R

Expression Region:1-128

Sequence Info:full length protein

View full details