Skip to product information
1 of 1

Gene Bio Systems

Recombinant Varicella-zoster virus Structural protein 1(ORF1)

Recombinant Varicella-zoster virus Structural protein 1(ORF1)

SKU:CSB-CF678402VAQ

Regular price £1,212.00 GBP
Regular price Sale price £1,212.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus 3)

Uniprot NO.:Q4JQX4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSRVSEYGVPEGVRESDSDTDSVFMYQHTELMQNNASPLVVRARPPAVLIPLVDVPRPRS RRKASAQLKMQMDRLCNVLGVVLQMATLALVTYIAFVVHTRATSCKRE

Protein Names:Recommended name: Structural protein 1 Alternative name(s): Structural ORF1 protein

Gene Names:ORF Names:ORF1

Expression Region:1-108

Sequence Info:full length protein

View full details