Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Virion membrane protein A9 (MVA120L, ACAM3000_MVA_120)

Recombinant Vaccinia virus Virion membrane protein A9 (MVA120L, ACAM3000_MVA_120)

SKU:CSB-CF525211VEE

Regular price £1,053.00 GBP
Regular price Sale price £1,053.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Ankara) (VACV)

Uniprot NO.:O57222

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:AIDLCRHFFMYFCEQKLRPNSFWFVVVRAIASMIMYLVLGIALLYISEQDNKKNTNNDKR NESSINSNSSPK

Protein Names:Recommended name: Virion membrane protein A9

Gene Names:Ordered Locus Names:MVA120L, ACAM3000_MVA_120 ORF Names:A9L

Expression Region:23-94

Sequence Info:full length protein

View full details