Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Protein J5(MVA089L, ACAM3000_MVA_089)

Recombinant Vaccinia virus Protein J5(MVA089L, ACAM3000_MVA_089)

SKU:CSB-CF758850VEE

Regular price £1,213.00 GBP
Regular price Sale price £1,213.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Ankara) (VACV)

Uniprot NO.:Q76VD9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDEQIYAFCDANKDDIRCKCIYPDKSIVRIGIDTRLPYYCWYEPCKRSDALLPASLKKN ITKCNVSDCTISLGNVSITDSKLDVNNVCDSKRVATENIAVRYLNQEIRYPIIDIKWLPI GLLALAILILAFF

Protein Names:Recommended name: Protein J5

Gene Names:Ordered Locus Names:MVA089L, ACAM3000_MVA_089

Expression Region:1-133

Sequence Info:full length protein

View full details