Gene Bio Systems
Recombinant V-type sodium ATPase subunit K(ntpK)
Recombinant V-type sodium ATPase subunit K(ntpK)
SKU:CSB-CF337407ELY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterococcus hirae
Uniprot NO.:P43457
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQL LPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQI LAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA
Protein Names:Recommended name: V-type sodium ATPase subunit K Alternative name(s): Na(+)-translocating ATPase subunit K Sodium ATPase proteolipid component
Gene Names:Name:ntpK Synonyms:ntpN
Expression Region:1-156
Sequence Info:full length protein
