Skip to product information
1 of 1

Gene Bio Systems

Recombinant V-type sodium ATPase subunit K(ntpK)

Recombinant V-type sodium ATPase subunit K(ntpK)

SKU:CSB-CF337407ELY

Regular price £1,228.00 GBP
Regular price Sale price £1,228.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Enterococcus hirae

Uniprot NO.:P43457

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMDYLITQNGGMVFAVLAMATATIFSGIGSAKGVGMTGEAAAALTTSQPEKFGQALILQL LPGTQGLYGFVIAFLIFINLGSDMSVVQGLNFLGASLPIAFTGLFSGIAQGKVAAAGIQI LAKKPEHATKGIIFAAMVETYAILGFVISFLLVLNA

Protein Names:Recommended name: V-type sodium ATPase subunit K Alternative name(s): Na(+)-translocating ATPase subunit K Sodium ATPase proteolipid component

Gene Names:Name:ntpK Synonyms:ntpN

Expression Region:1-156

Sequence Info:full length protein

View full details