Gene Bio Systems
Recombinant V-type proton ATPase 16 kDa proteolipid subunit 2-3(vha-2)
Recombinant V-type proton ATPase 16 kDa proteolipid subunit 2-3(vha-2)
SKU:CSB-CF717207CXX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis briggsae
Uniprot NO.:Q612A5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSYDLETAEHAAYAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVI PVIMAGIIGIYGLVVAMVLKGKVQAASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVG DAGVRGTAQQPRLFVGMILILIFSEVLGLYGMIVALILGTS
Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit 2/3 Short name= V-ATPase 16 kDa proteolipid subunit 2/3 Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit 2/3
Gene Names:Name:vha-2 ORF Names:CBG10000 ANDName: vha-3ORF Names: CBG16825
Expression Region:1-161
Sequence Info:full length protein
