Recombinant Ureaplasma parvum serovar 3  ATP synthase subunit c(atpE)

Recombinant Ureaplasma parvum serovar 3 ATP synthase subunit c(atpE)

CSB-CF882455UAO
Regular price
£866.00 GBP
Sale price
£866.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ureaplasma parvum serovar 3 (strain ATCC 700970)

Uniprot NO.:Q9PR08

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSFIDITNVISSHIEANLPAIASENVGSLANGAGIAYLGKYIGTGITMLAAGAVGLMQG FSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSILIIFVA

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Ordered Locus Names:UU136

Expression Region:1-109

Sequence Info:full length protein

Your list is ready to share