Gene Bio Systems
Recombinant UPF0719 transmembrane protein Rv2600-MT2674.1 (Rv2600, MT2674.1)
Recombinant UPF0719 transmembrane protein Rv2600-MT2674.1 (Rv2600, MT2674.1)
SKU:CSB-CF304765MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P68915
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYQAGVDFGTISLTPILHGVVATVLYFLVGAAVLVAGFLMVNLLTPGDLRRLVFIDRRPN AVVLAATMYVALAIVTIAAIYASSNQLAQGLIGVAVYGIVGVALQGVALVILEIAVPGRF REHIDAPALHPAVFATAVMLLAVAGVIAAALS
Protein Names:Recommended name: UPF0719 transmembrane protein Rv2600/MT2674.1
Gene Names:Ordered Locus Names:Rv2600, MT2674.1 ORF Names:MTCY227.01c
Expression Region:1-152
Sequence Info:full length protein
