Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0442 protein yjjB(yjjB)

Recombinant UPF0442 protein yjjB(yjjB)

SKU:CSB-CF845573SWW

Regular price £1,230.00 GBP
Regular price Sale price £1,230.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmonella typhi

Uniprot NO.:Q8Z0W0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGLRMLMMSAGFNIE WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV

Protein Names:Recommended name: UPF0442 protein yjjB

Gene Names:Name:yjjB Ordered Locus Names:STY4898, t4588

Expression Region:1-157

Sequence Info:full length protein

View full details