Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0316 protein BA_3420-GBAA_3420-BAS3170(BA_3420, GBAA_3420, BAS3170)

Recombinant UPF0316 protein BA_3420-GBAA_3420-BAS3170(BA_3420, GBAA_3420, BAS3170)

SKU:CSB-CF774089BQE

Regular price £1,253.00 GBP
Regular price Sale price £1,253.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q81MZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAAVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDHH VS

Protein Names:Recommended name: UPF0316 protein BA_3420/GBAA_3420/BAS3170

Gene Names:Ordered Locus Names:BA_3420, GBAA_3420, BAS3170

Expression Region:1-182

Sequence Info:full length protein

View full details