Gene Bio Systems
Recombinant UPF0295 protein BA_0538-GBAA_0538-BAS0506(BA_0538, GBAA_0538, BAS0506)
Recombinant UPF0295 protein BA_0538-GBAA_0538-BAS0506(BA_0538, GBAA_0538, BAS0506)
SKU:CSB-CF772371BQE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:Q81YU3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS
Protein Names:Recommended name: UPF0295 protein BA_0538/GBAA_0538/BAS0506
Gene Names:Ordered Locus Names:BA_0538, GBAA_0538, BAS0506
Expression Region:1-118
Sequence Info:full length protein
