Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein YPO1740-y2567-YP_1481(YPO1740, y2567, YP_1481)

Recombinant Uncharacterized protein YPO1740-y2567-YP_1481(YPO1740, y2567, YP_1481)

SKU:CSB-CF849373YAS

Regular price £1,177.00 GBP
Regular price Sale price £1,177.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Yersinia pestis

Uniprot NO.:Q8ZFG9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLDTNMSAFGVASIALPLLTVLFFLIVWFFLSRASVRANEQVRLLREIAEQQKRQTELLT ALLENATGTRDGQNDSDTVSPLDFKGFIPER

Protein Names:Recommended name: Uncharacterized protein YPO1740/y2567/YP_1481

Gene Names:Ordered Locus Names:YPO1740, y2567, YP_1481

Expression Region:1-91

Sequence Info:full length protein

View full details