Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv2272-MT2333 (Rv2272, MT2333)

Recombinant Uncharacterized protein Rv2272-MT2333 (Rv2272, MT2333)

SKU:CSB-CF353231MVZ

Regular price £1,199.00 GBP
Regular price Sale price £1,199.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64969

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MADDSNDTATDVEPDYRFTLANERTFLAWQRTALGLLAAAVALVQLVPELTIPGARQVLG VVLAILAILTSGMGLLRWQQADRAMRRHLPLPRHPTPGYLAVGLCVVGVVALALVVAKAI TG

Protein Names:Recommended name: Uncharacterized protein Rv2272/MT2333

Gene Names:Ordered Locus Names:Rv2272, MT2333 ORF Names:MTCY339.38c

Expression Region:1-122

Sequence Info:full length protein

View full details