Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv1989c-MT2043 (Rv1989c, MT2043)

Recombinant Uncharacterized protein Rv1989c-MT2043 (Rv1989c, MT2043)

SKU:CSB-CF353819MVZ

Regular price £1,254.00 GBP
Regular price Sale price £1,254.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64907

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLA DSAQACMVEVERAAQAASTTAEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDI YGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQRTRPGQLQLRQSVDLTPALY QELRAT

Protein Names:Recommended name: Uncharacterized protein Rv1989c/MT2043

Gene Names:Ordered Locus Names:Rv1989c, MT2043 ORF Names:MTCY39.30

Expression Region:1-186

Sequence Info:full length protein

View full details