Gene Bio Systems
Recombinant Uncharacterized protein Rv1824-MT1872 (Rv1824, MT1872)
Recombinant Uncharacterized protein Rv1824-MT1872 (Rv1824, MT1872)
SKU:CSB-CF355002MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P64893
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLE RIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFG A
Protein Names:Recommended name: Uncharacterized protein Rv1824/MT1872
Gene Names:Ordered Locus Names:Rv1824, MT1872 ORF Names:MTCY1A11.19c
Expression Region:1-121
Sequence Info:full length protein
