Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv0970-MT0998 (Rv0970, MT0998)

Recombinant Uncharacterized protein Rv0970-MT0998 (Rv0970, MT0998)

SKU:CSB-CF354383MVZ

Regular price £1,299.00 GBP
Regular price Sale price £1,299.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64781

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIHDLMLRWVVTGLFVLTAAECGLAIIAKRRPWTLIVNHGLHFAMAVAMAVMAWPWGARV PTTGPAVFFLLAAVWFGATAVVAVRGTATRGLYGYHGLMMLATAWMYAAMNPRLLPVRSC TEYATEPDGSMPAMDMTAMNMPPNSGSPIWFSAVNWIGTVGFAVAAVFWACRFVMERRQE ATQSRLPGSIGQAMMAAGMAMLFFAMLFPV

Protein Names:Recommended name: Uncharacterized protein Rv0970/MT0998

Gene Names:Ordered Locus Names:Rv0970, MT0998 ORF Names:MTCY10D7.04c

Expression Region:1-210

Sequence Info:full length protein

View full details