Gene Bio Systems
Recombinant Uncharacterized protein Rv0961-MT0989 (Rv0961, MT0989)
Recombinant Uncharacterized protein Rv0961-MT0989 (Rv0961, MT0989)
SKU:CSB-CF353788MVZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Mycobacterium tuberculosis
Uniprot NO.:P64775
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHV FPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH
Protein Names:Recommended name: Uncharacterized protein Rv0961/MT0989
Gene Names:Ordered Locus Names:Rv0961, MT0989 ORF Names:MTCY10D7.13c
Expression Region:1-115
Sequence Info:full length protein
