Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein pXO2-27-BXB0026-GBAA_pXO2_0026(pXO2-27, BXB0026, GBAA_pXO2_0026)

Recombinant Uncharacterized protein pXO2-27-BXB0026-GBAA_pXO2_0026(pXO2-27, BXB0026, GBAA_pXO2_0026)

SKU:CSB-CF865706BQE

Regular price £1,206.00 GBP
Regular price Sale price £1,206.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q9RN05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVLTYSSAKKQIIFMALYFVITGIVIRLIGYSLQGSLSAFTQAGIGDLLSGNFSVKDMF HFDFSFDMSQFDGFSLNMWGVFIKDKIHSVVNDMMPTTLGAINMLMLSKYLTLERAIKLG IKLY

Protein Names:Recommended name: Uncharacterized protein pXO2-27/BXB0026/GBAA_pXO2_0026

Gene Names:Ordered Locus Names:pXO2-27, BXB0026, GBAA_pXO2_0026

Expression Region:1-124

Sequence Info:full length protein

View full details