Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein ML1584(ML1584)

Recombinant Uncharacterized protein ML1584(ML1584)

SKU:CSB-CF871719MVN

Regular price £1,193.00 GBP
Regular price Sale price £1,193.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium leprae

Uniprot NO.:Q9CBU2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASTEGEHNAGVDPAEVPSVAWGWSRINHHTWHIVGLFAIGLLLAMLRGNHIGHVENWYL IGFAALVFFVLIRDLLGRRRGWIR

Protein Names:Recommended name: Uncharacterized protein ML1584

Gene Names:Ordered Locus Names:ML1584

Expression Region:1-84

Sequence Info:full length protein

View full details