Recombinant Uncharacterized protein Mb1377c (Mb1377c)

CSB-CF363694MVH

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium bovis

Uniprot NO.:P0A5E8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTAPETPAAQHAEPAIAVERIRTALLGYRIMAWTTGLWLIALCYEIVVRYVVKVDNPPTW IGVVHGWVYFTYLLLTLNLAVKVRWPLGKTAGVLLAGTIPLLGIVVEHFQTKEIKARFGL

Protein Names:Recommended name: Uncharacterized protein Mb1377c

Gene Names:Ordered Locus Names:Mb1377c

Expression Region:1-120

Sequence Info:full length protein