Gene Bio Systems
Recombinant Uncharacterized membrane protein yqzK(yqzK)
Recombinant Uncharacterized membrane protein yqzK(yqzK)
SKU:CSB-CF496587BRI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis
Uniprot NO.:C0H451
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGRFLKTAVDALKVFILFTGFTALFYYAMIWVNQEYENYHRYDKPEGSAVKVVEMDQDEK GGWFDRLIFFYQNGE
Protein Names:Recommended name: Uncharacterized membrane protein yqzK
Gene Names:Name:yqzK Ordered Locus Names:BSU23519
Expression Region:1-75
Sequence Info:full length protein
