Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized membrane protein Rv0364-MT0380 (Rv0364, MT0380)

Recombinant Uncharacterized membrane protein Rv0364-MT0380 (Rv0364, MT0380)

SKU:CSB-CF520865MVZ

Regular price £1,293.00 GBP
Regular price Sale price £1,293.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:O06314

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFPLLPGESLLFTGGLLS ASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDSRFFKKHYVTESHAFFE KYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGVAWGAGVTLAGYFLGSVP FVHMNFQLIILAIVFVSLLPALVSAARVYRARRNAPQSDPDPLVLPE

Protein Names:Recommended name: Uncharacterized membrane protein Rv0364/MT0380

Gene Names:Ordered Locus Names:Rv0364, MT0380 ORF Names:MTCY13E10.26

Expression Region:1-227

Sequence Info:full length protein

View full details