Gene Bio Systems
Recombinant Trichodesmium erythraeum Photosystem I reaction center subunit XI(psaL)
Recombinant Trichodesmium erythraeum Photosystem I reaction center subunit XI(psaL)
SKU:CSB-CF607562TPX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Trichodesmium erythraeum (strain IMS101)
Uniprot NO.:Q116L4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTQATDSGFVQPYKGDPFVGHLSTPISDSDFTRAFIGNLPIYRPGLSPILRGLEVGMAHG YFIVGPWTKLGPLRDSAVANLGGLISTIALVLIATICLSAYGLVSFQGKSPEGADPLKTS EGWSQFTGGFFIGAMGGAVVAFFLLENFELVDSIFRGLFNS
Protein Names:Recommended name: Photosystem I reaction center subunit XI Alternative name(s): PSI subunit V PSI-L
Gene Names:Name:psaL Ordered Locus Names:Tery_1204
Expression Region:1-161
Sequence Info:full length protein
