Gene Bio Systems
Recombinant Trachypithecus cristatus Cytochrome c oxidase subunit 6C(COX6C)
Recombinant Trachypithecus cristatus Cytochrome c oxidase subunit 6C(COX6C)
SKU:CSB-CF767174TOY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Trachypithecus cristatus (Silvered leaf-monkey) (Presbytis cristata)
Uniprot NO.:Q7YRK1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:APEVLPKPQMRGLLAKRLRFHMVTAFVLSLGVAALYKFRVADKRKKAYADFYRNYDAMKD FEEMRKAGIFQSVK
Protein Names:Recommended name: Cytochrome c oxidase subunit 6C Alternative name(s): Cytochrome c oxidase polypeptide VIc
Gene Names:Name:COX6C
Expression Region:2-75
Sequence Info:full length protein
