Skip to product information
1 of 1

Gene Bio Systems

Recombinant Tobacco necrosis virus Uncharacterized protein p6 (ORF3)

Recombinant Tobacco necrosis virus Uncharacterized protein p6 (ORF3)

SKU:CSB-CF326691TFH

Regular price £1,151.00 GBP
Regular price Sale price £1,151.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Tobacco necrosis virus (strain D) (TNV)

Uniprot NO.:P27212

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAYIIVHQRDPFPLLGVWIIVIIIVAVIGLLNQSPPERPYQTFKEDNSKIQYITIGGSTT TKVSTS

Protein Names:Recommended name: Uncharacterized protein p6

Gene Names:ORF Names:ORF3

Expression Region:1-66

Sequence Info:full length protein

View full details