Gene Bio Systems
Recombinant Tobacco necrosis virus Uncharacterized protein p6 (ORF3)
Recombinant Tobacco necrosis virus Uncharacterized protein p6 (ORF3)
SKU:CSB-CF326691TFH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Tobacco necrosis virus (strain D) (TNV)
Uniprot NO.:P27212
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAYIIVHQRDPFPLLGVWIIVIIIVAVIGLLNQSPPERPYQTFKEDNSKIQYITIGGSTT TKVSTS
Protein Names:Recommended name: Uncharacterized protein p6
Gene Names:ORF Names:ORF3
Expression Region:1-66
Sequence Info:full length protein
