Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermotoga maritima UPF0092 membrane protein TM_0859(TM_0859)

Recombinant Thermotoga maritima UPF0092 membrane protein TM_0859(TM_0859)

SKU:CSB-CF893045TNJ

Regular price £1,223.00 GBP
Regular price Sale price £1,223.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

Uniprot NO.:Q9WZW3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPEIIYAAAPGASNGTTTTATGGGWGSLLFMLIFFIAIFYFMIILPQRRREKQFQQMISQ MKRGDTVVTIGGIVGKVIDIKKDTVKIKTANSTELEITKRAISTVIKERSQENQEG

Protein Names:Recommended name: UPF0092 membrane protein TM_0859

Gene Names:Ordered Locus Names:TM_0859

Expression Region:1-116

Sequence Info:full length protein

View full details