Skip to product information
1 of 1

Gene Bio Systems

Recombinant Thermofilum pendens UPF0290 protein Tpen_0433 (Tpen_0433)

Recombinant Thermofilum pendens UPF0290 protein Tpen_0433 (Tpen_0433)

SKU:CSB-CF377635TKC

Regular price £1,294.00 GBP
Regular price Sale price £1,294.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Thermofilum pendens (strain Hrk 5)

Uniprot NO.:A1RXB2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRISVYACFLGLYFLVFSLIVYVILGAEFLVSVLQPGNVARSMLWVLPAYVANASPVVFS RLVRKRWRLHPMDFGLTFVDGQRLLGDNKTFEGFLGGMLSGVLVGILLAYARFVDGVSAF LLPLGALLGDLGGAFVKRRLRIKPGEPAILLDQLDFVAGALILQGLFSKLPAAEVVVAVV LLTPIVHLLTNMAAFVLGLKDVPW

Protein Names:Recommended name: UPF0290 protein Tpen_0433

Gene Names:Ordered Locus Names:Tpen_0433

Expression Region:1-204

Sequence Info:full length protein

View full details